Item added to cart
Details:Arrowhead mills natural puffed millet cereal give you a delicious nutritious start to your day Millet is the smallest of all grains and has been used longer than rice or wheat It has a mild flavor with a whole lot of whole grain goodness You’ll get 2 g Of protein and 2 g Of fiber per serving And it has only 60 calories per serving This all natural product has no cholesterol and has no sugar or salt added Includes one 6 oz Bag of arrowhead mills natural puffed millet cereal As arrowhead mills has grown our brand and our product line have grown with us Over the years weve added hot and cold cereals as well as delicious pancake waffle cake and brownie mixes nut butters seasonal products and gluten-free products&mdashall of which taste great are all-natural and are entirely free of chemical pesticides and herbicidescountry of origin : united statesis gmo free : yesis kosher : yesis wheat free : yessize : 6 ozpack of : 12selling unit : casekeywords : branbreakfastflakesgrainshealthymilkwheatwhole
Actual product packaging and materials may contain more and/or different information than that shown on our website. We recommend that you do not solely rely on the information presented and that you always read labels, warnings, and directions before using or consuming a product.
For additional information about a product, please contact the manufacturer. Content on this site is for reference purposes and is not intended to substitute for advice given by a physician, pharmacist, or other licensed health-care professional. ZiFiti does not assume liability for inaccuracies or misstatements about products.
Statements regarding dietary supplements have not been evaluated by the FDA and are not intended to diagnose, treat, cure, or prevent any disease or health condition.
Copyright © 2016 - 2025 ZiFiti, LLC.
